PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 113aa    MW: 12900.1 Da    PI: 9.8509
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14182genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.6e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+v+   +g+W+  ++  g++R++k+c++rw +yl
         EMT14182 15 KGPWTPEEDKLLVDYVQANAPGNWRMLPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-23765IPR009057Homeodomain-like
PROSITE profilePS5129423.9961066IPR017930Myb domain
SMARTSM007179.5E-131464IPR001005SANT/Myb domain
PfamPF002491.8E-151562IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-231690IPR009057Homeodomain-like
CDDcd001672.79E-101762No hitNo description
PROSITE profilePS500903.90363113IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-86689IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MGRTPCCESR QGLKKGPWTP EEDKLLVDYV QANAPGNWRM LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGP FTPEEHKSIL QLHAIVGNKS VLLLLLLTHF VPLQYTCVSS HVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-17139725108MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-98AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581451.17e-56PREDICTED: myb-related protein Myb4-like
SwissprotO497825e-41MYB51_ARATH; Transcription factor MYB51
TrEMBLN1QV872e-80N1QV87_AEGTA; Transcription factor MYB39
STRINGMLOC_68698.12e-62(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.12e-46myb domain protein 74